Transcript | Ll_transcript_141026 |
---|---|
CDS coordinates | 2754-3722 (+) |
Peptide sequence | MLNFASNSVSCLFSDFIVFVFPGYRIRAGSASPVHRRDANHRFGSDYNHLSQSRGYGGGRDPGRYRDPSPPYFRGKVGGRPVGRAFDRPGFVPGLARGEGNSRNNPNVRPREGDWICPDIRCGNLNFARRDYCNKCNRSRPAPAESPRRAYPGPPPLRSSPRRFPGSPERTVIGYRSPPRGLARDGPREYGSAALPPLRHEGRFTDPHLHKDRIDYLEDAYRGRNKFDRPPPPLEWESRDRGRNGFSNERKAFERRPLSPHAPLLPSLPPHHGGRWAQDVRERSRSPIRGSPPPKDYRRDMFVNRGRGDRRALGRDRTGGMY* |
ORF Type | complete |
Blastp | Zinc finger Ran-binding domain-containing protein 2 from Sus with 56.41% of identity |
---|---|
Blastx | TATA-binding protein-associated factor 2N from Homo with 64.29% of identity |
Eggnog | Zinc finger, RAN-binding domain containing 2(ENOG4111QXA) |
Kegg | Link to kegg annotations (733651) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448374.1) |
Pfam | Zn-finger in Ran binding protein and others (PF00641.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer