Protein coding transcript 175657

• Transcript: Ll_transcript_142116
• CDS coordinates: 696-995 (+)
• Peptide sequence: MDPCGCGMMNNNTSSYSLPEMWHFPPPLNFEDNALNDGNGKRVRGIGKMKVEVDGSSRKGGEEQRNKGTGSDNLKQDYIHVRARRGQATDSHSLAERVI*
• ORF Type: complete

Annotations of Ll_transcript_142116

• Blastp: Transcription factor bHLH77 from Arabidopsis with 55% of identity
• Blastx: Transcription factor bHLH77 from Arabidopsis with 55% of identity
• Eggnog: Helix-loop-helix DNA-binding domain(ENOG41108J6)
• Kegg: Link to kegg annotations (AT3G23690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431018.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;