Protein coding transcript 175658

• Transcript: Ll_transcript_142118
• CDS coordinates: 696-1115 (+)
• Peptide sequence: MDPCGCGMMNNNTSSYSLPEMWHFPPPLNFEDNALNDGNGKRVRGIGKMKVEVDGSSRKGGEEQRNKGTGSDNLKQDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNKVIGKALILDEIINYIQSLQRQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_142118

• Blastp: Transcription factor BHLH089 from Oryza sativa with 62.5% of identity
• Blastx: Transcription factor BHLH089 from Oryza sativa with 62.5% of identity
• Eggnog: Transcription factor(ENOG410YAFX)
• Kegg: Link to kegg annotations (4334471)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431018.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;