Protein coding transcript 17568

• Transcript: Ll_transcript_356565
• CDS coordinates: 1-1062 (+)
• Peptide sequence: EMVSKGIQPNLVTYTCLIHGLCNSGRWKEASTLLSEMMQKGIFPNVQTFTILVDAFCKEGLIMGAKSIISYMIQMGEEPNVVTYNSLITGYCLQNKMNEATKVFDLMIDKGCLPSIVTYNSLIHGWCKIKNVDKAIYLLGEVVNKGLDPDIATLNTLIGGFCKAWKPLAAKELFFTMHKYGQFPDLQTCAIILDGLFKCNSHSEAISLFREIEKMNLDLHILIYNIMLDGMCSSGKTKDARKLFSSLPAKGLKFDVYTYTIMIQGLCKEGLLDDAEDLLINMEEDGCMPDMCTYNVLVQGLLRKYDFSRSKKYLQIMKDKGFSIDATTTELLIYSFSANERNDHLHEFLQKNA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_356565

• Blastp: Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial from Arabidopsis with 42% of identity
• Blastx: Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial from Arabidopsis with 43.54% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G12700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418111.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;