| Transcript | Ll_transcript_141455 |
|---|---|
| CDS coordinates | 3-350 (+) |
| Peptide sequence | PNLSIEELMTGVSFASAGSGFDPLTPTMTNVIPIDKQLEYFKECRKRVEVVLGKERTENHIKKGVFFISAGTNDFVLNYFTLPIQRNRYTLLAYQHFLIQHVKEFIQVWFYFPNS* |
| ORF Type | 5prime_partial |
| Blastp | GDSL esterase/lipase At5g45960 from Arabidopsis with 60% of identity |
|---|---|
| Blastx | GDSL esterase/lipase At5g45960 from Arabidopsis with 60% of identity |
| Eggnog | GDSL esterase lipase(COG3240) |
| Kegg | Link to kegg annotations (AT5G45960) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418226.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer