Protein coding transcript 175745

• Transcript: Ll_transcript_141461
• CDS coordinates: 2648-3067 (+)
• Peptide sequence: MGCLPVMITINSPGAFLKRDCITKYSSTARDYNILLQHELHAMQLHLNTINKGAKLYYVDIYGPIADMIQTPQKFGFDEVSSGCCGSGYIEASYMCNKNSEVCSDPSKYVFWDSIHPTAKAYHHLFLTSLPIIDSIMNN*
• ORF Type: complete

Annotations of Ll_transcript_141461

• Blastp: GDSL esterase/lipase At5g45960 from Arabidopsis with 50.36% of identity
• Blastx: GDSL esterase/lipase At5g45960 from Arabidopsis with 51.68% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT5G45960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418226.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;