Protein coding transcript 17576

• Transcript: Ll_transcript_356566
• CDS coordinates: 1030-1914 (+)
• Peptide sequence: MVSGAKSVLSFMIQMGEEPNVVTYNSLLDGYCLQNQMEEAMKIFKLMVQKNCLPTVVTYNLLINGWCKIKDIDTAISLLGEMVNKGLHPDVVTWTTLIGGFCKVGKPLAAKELFFTMNKFGQVPNLQTCAIILDGLFKCHFHSEAMSLFREMEIINLDLDIVVYNIMLDGMCKAGKLSDARRLLSCMRAKGLKIDAYTYNTMIRGLCKEGLLDDAEELLVEMEEKDCPPNKCSYNVFVQGLLRKCDISRSRKYLQIMKGKGFPLDATTMELIIDFFSTNKEDNALQDLLQLKFV*
• ORF Type: complete

Annotations of Ll_transcript_356566

• Blastp: Pentatricopeptide repeat-containing protein At3g22470, mitochondrial from Arabidopsis with 40.56% of identity
• Blastx: Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial from Arabidopsis with 38.31% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT3G22470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464912.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;