Transcript | Ll_transcript_141501 |
---|---|
CDS coordinates | 95-697 (+) |
Peptide sequence | MLSSIAKLPFSLTIRSSSSKDVTLREDWRNRSRPIPPGGTYPAKDHCSRCGLCDTYYIAHVKNACAFLGDGMSRIEKLEPVVHGRGRKTDTLDETYLGVHEELLYARKINPVEGAQWTGIVTTIAIEMLKSGMVEAVVCVQSDPDDRLAPRPVLARTPEEVLAAKGVKPTLSPNLDTLALVEAAGVKRLLFCGVGCQVQE* |
ORF Type | complete |
Blastp | 7-hydroxymethyl chlorophyll a reductase, chloroplastic from Arabidopsis with 86.67% of identity |
---|---|
Blastx | 7-hydroxymethyl chlorophyll a reductase, chloroplastic from Arabidopsis with 86.67% of identity |
Eggnog | Coenzyme F420 hydrogenase(COG1035) |
Kegg | Link to kegg annotations (AT1G04620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413708.1) |
Pfam | Coenzyme F420 hydrogenase/dehydrogenase, beta subunit N-term (PF04422.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer