Protein coding transcript 175774

• Transcript: Ll_transcript_141482
• CDS coordinates: 95-697 (+)
• Peptide sequence: MLSSIAKLPFSLTIRSSSSKDVTLREDWRNRSRPIPPGGTYPAKDHCSRCGLCDTYYIAHVKNACAFLGDGMSRIEKLEPVVHGRGRKTDTLDETYLGVHEELLYARKINPVEGAQWTGIVTTIAIEMLKSGMVEAVVCVQSDPDDRLAPRPVLARTPEEVLAAKGVKPTLSPNLDTLALVEAAGVKRLLFCGVGCQVQE*
• ORF Type: complete

Annotations of Ll_transcript_141482

• Blastp: 7-hydroxymethyl chlorophyll a reductase, chloroplastic from Arabidopsis with 86.67% of identity
• Blastx: 7-hydroxymethyl chlorophyll a reductase, chloroplastic from Arabidopsis with 83.27% of identity
• Eggnog: Coenzyme F420 hydrogenase(COG1035)
• Kegg: Link to kegg annotations (AT1G04620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413708.1)
• Pfam: Coenzyme F420 hydrogenase/dehydrogenase, beta subunit N-term (PF04422.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;