| Transcript | Ll_transcript_141910 |
|---|---|
| CDS coordinates | 317-670 (+) |
| Peptide sequence | MSSINTIPSHIKAWIYSEYGKTQDILKFDHNLPIPHIKDDQALIKVVAAALNPIDYKRASGNFKTFAIPLPVRLSFLFMVFDSVVVIILKIMFCILLFNFVCGGQRLFQGTMLLVWL* |
| ORF Type | complete |
| Blastp | 2-methylene-furan-3-one reductase from Fragaria with 63.24% of identity |
|---|---|
| Blastx | 2-methylene-furan-3-one reductase from Fragaria with 73.04% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019434347.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer