| Transcript | Ll_transcript_141953 |
|---|---|
| CDS coordinates | 2-337 (+) |
| Peptide sequence | SSLRSPAISSGLSSGVVHLGSSSVLERPGDSEYAIAPSLRSLPGAGSGRIVSELRDVLGRMRRGRNLRLEDVMILNQSLFPGIADNHDRHRDMRLDVDNMSYEELLALEERI |
| ORF Type | internal |
| Blastp | E3 ubiquitin-protein ligase MBR1 from Arabidopsis with 64% of identity |
|---|---|
| Blastx | Probable E3 ubiquitin-protein ligase RHG1A from Arabidopsis with 56.99% of identity |
| Eggnog | zinc ion binding(ENOG41121N2) |
| Kegg | Link to kegg annotations (AT2G15530) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019436945.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer