Protein coding transcript 175929

• Transcript: Ll_transcript_141401
• CDS coordinates: 3-719 (+)
• Peptide sequence: RLQFKDPVAGRSHFPARLVRFRLTMAAVENEKTGSDGKVWSFCKMPFWETTHPSSSSSSASSTFSSMHGSVHQQSQILQSLDRSTHQPSTTVSSLAKSLFPTRRRLRLDPPNKLYFPYEPGKQVRSAITIKNTCKSHVAFKFQTTAPKSCYMRPPGGVLAPSESIIATVFKFVEPPENNEKPIEQKSRVKFKIMSLKVKGEMDYVPELVMYYCYLGLNVNCLLNYIIIFPMLNKSFNN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_141401

• Blastp: Vesicle-associated protein 4-2 from Arabidopsis with 57.01% of identity
• Blastx: Vesicle-associated protein 4-2 from Arabidopsis with 83.47% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G21450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453744.1)
• Pfam: MSP (Major sperm protein) domain (PF00635.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;