Protein coding transcript 175970

• Transcript: Ll_transcript_143313
• CDS coordinates: 140-1081 (+)
• Peptide sequence: MWRRSFSSSAATAAAALKHKKWDALIIGGGHNGLTAAAYLARGGLSVAVLERRHIIGGAAVTEDIIPGFKFSRCSYLQSLLRPSIIKELDLSKHGLKLLKRSPSSFTPCLDGRYLLLGPDKDLNHSEISKFSRKDAEAYPRYESKLENYCKFMDLVLDSPPPESLQHKSSLNEQLKNKIQNSVFWASCLRQASSLGQKDMVDFMDLLLSPASKVLNNWFESDILKATLATDAVIGSTASVHTAGSGYVLLHHVMGETDGDRGIWSHVEGGMGSISKAIGNAAMEAGAQVITNVEVSQLLVDNSSTVYGVSVVH*
• ORF Type: complete

Annotations of Ll_transcript_143313

• Blastp: Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 from Rattus with 50.16% of identity
• Blastx: Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 from Rattus with 51.34% of identity
• Eggnog: phytoene(COG1233)
• Kegg: Link to kegg annotations (309381)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446764.1)
• Pfam: Thi4 family (PF01946.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;