Protein coding transcript 175976

• Transcript: Ll_transcript_143318
• CDS coordinates: 140-1549 (+)
• Peptide sequence: MWRRSFSSSAATAAAALKHKKWDALIIGGGHNGLTAAAYLARGGLSVAVLERRHIIGGAAVTEDIIPGFKFSRCSYLQSLLRPSIIKELDLSKHGLKLLKRSPSSFTPCLDGRYLLLGPDKDLNHSEISKFSRKDAEAYPRYESKLENYCKFMDLVLDSPPPESLQHKSSLNEQLKNKIQNSVFWASCLRQASSLGQKDMVDFMDLLLSPASKVLNNWFESDILKATLATDAVIGSTASVHTAGSGYVLLHHVMGETDGDRGIWSHVEGGMGSISKAIGNAAMEAGAQVITNVEVSQLLVDNSSTVYGVILADGTEVHSSVVLSNATPYRTFVELVPDNVLPDDFVRAIKNSDYSSATTKINVAVDKLPQFRSCKLDHPHFGPQHVGTIHIGSESMEEIHSASQDAVNGVPSRRPIMEMTIPSVLDKTISPPGKHVINLFVQYTPYKPLDGDWQDHDYRVSLFCVFFMH*
• ORF Type: complete

Annotations of Ll_transcript_143318

• Blastp: Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 from Bos with 47.45% of identity
• Blastx: Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 from Mus with 49.44% of identity
• Eggnog: phytoene(COG1233)
• Kegg: Link to kegg annotations (519120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446764.1)
• Pfam: NAD(P)-binding Rossmann-like domain (PF13450.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;