Protein coding transcript 175988

• Transcript: Ll_transcript_141202
• CDS coordinates: 144-851 (+)
• Peptide sequence: MASWNSVPLHVSYEVLGWVAFVSWSISFYPQVILNFRRKSVVGLNFDFVILNLTKHSCYLIYNCSLYFSSVIQKQYKDKYGHKEMIPVAPNDVAFSCHAVLLTAISLFQIAIYDRGNQKVSKIAFAIVIVAWLTAAVCFFVTLHNHHWLWLLNIFSGIQVCMTIIKYIPQAVMNFMRKSTSGWSIGNILLDFSGGIANYLQMVMQSIDQGVSSHLPMDFLVLIYSVIVHCHNFRG*
• ORF Type: complete

Annotations of Ll_transcript_141202

• Blastp: Cystinosin homolog from Arabidopsis with 74.16% of identity
• Blastx: Cystinosin homolog from Arabidopsis with 73.81% of identity
• Eggnog: cystinosin(ENOG410XQSD)
• Kegg: Link to kegg annotations (AT5G40670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458854.1)
• Pfam: PQ loop repeat (PF04193.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;