Protein coding transcript 176076

• Transcript: Ll_transcript_142221
• CDS coordinates: 262-1110 (+)
• Peptide sequence: MSVSGLSGCPSRCFPTPPCRLGLRHVRVMAFSVAGKYNRVAEFLQPERTSFSSPALKWNTRQVQLVKSAMDASFGDITNESAAVFPRINVGDPYKRLGISREASEDEIQGARNFLIQKYSGHKPSLDAIEWAHDKIIMQQFYDRKNPKIDVRKKIREVNQSRFVQFIRGRFHTPSTNFIIKSSLAFLLLGVLTVLFPTEEGPTLQVALSLIATMYFVHERLKSKFRTFLYGAGAFIVSWLLGTFLMVAVIPPIPILKGLRAFEVITSLITYLLLWVSSTYLK*
• ORF Type: complete

Annotations of Ll_transcript_142221

• Blastp: Protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic from Arabidopsis with 37% of identity
• Blastx: Protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic from Arabidopsis with 37% of identity
• Eggnog: Protein of unknown function (DUF3353)(ENOG4111K86)
• Kegg: Link to kegg annotations (AT5G23040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446872.1)
• Pfam: Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;