Transcript | Ll_transcript_142221 |
---|---|
CDS coordinates | 262-1110 (+) |
Peptide sequence | MSVSGLSGCPSRCFPTPPCRLGLRHVRVMAFSVAGKYNRVAEFLQPERTSFSSPALKWNTRQVQLVKSAMDASFGDITNESAAVFPRINVGDPYKRLGISREASEDEIQGARNFLIQKYSGHKPSLDAIEWAHDKIIMQQFYDRKNPKIDVRKKIREVNQSRFVQFIRGRFHTPSTNFIIKSSLAFLLLGVLTVLFPTEEGPTLQVALSLIATMYFVHERLKSKFRTFLYGAGAFIVSWLLGTFLMVAVIPPIPILKGLRAFEVITSLITYLLLWVSSTYLK* |
ORF Type | complete |
Blastp | Protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic from Arabidopsis with 37% of identity |
---|---|
Blastx | Protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic from Arabidopsis with 37% of identity |
Eggnog | Protein of unknown function (DUF3353)(ENOG4111K86) |
Kegg | Link to kegg annotations (AT5G23040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446872.1) |
Pfam | Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer