Protein coding transcript 176080

• Transcript: Ll_transcript_142257
• CDS coordinates: 261-869 (+)
• Peptide sequence: MSAVFPRINVGDPYKRLGISREASEDEIQGARNFLIQKYSGHKPSLDAIEWAHDKIIMQQFYDRKNPKIDVRKKIREVNQSRFVQFIRGRFHTPSTNFIIKSSLAFLLLGVLTVLFPTEEGPTLQVALSLIATMYFVHERLKSKFRTFLYGAGAFIVSWLLGTFLMVAVIPPIPILKGLRAFEVITSLITYLLLWVSSTYLK*
• ORF Type: complete

Annotations of Ll_transcript_142257

• Blastp: Protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic from Nicotiana with 40% of identity
• Blastx: Protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic from Nicotiana with 40% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446872.1)
• Pfam: Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;