Protein coding transcript 176096

• Transcript: Ll_transcript_141893
• CDS coordinates: 189-758 (+)
• Peptide sequence: MSLSPDRVRVRGRSPAFNALAATFENPNARNLSTPPPVIRKLYPKSVTPDSALLAPKSTSIATLSSSFEQPPPAGGSIMPQSLKATPITPKSNPETNDKETSVTSRMESLTIQEDVKEDEAEDEEGLPIYPYERLKITSTDPATDIDVTRRETYLSSVEFKEKFGMAKDSFYKLPKWKQNKLKMAIQLF*
• ORF Type: complete

Annotations of Ll_transcript_141893

• Blastp: Villin-4 from Arabidopsis with 67.98% of identity
• Blastx: Villin-4 from Arabidopsis with 67.39% of identity
• Eggnog: capping protein (actin filament) gelsolin-like(ENOG410XR0A)
• Kegg: Link to kegg annotations (AT4G30160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433575.1)
• Pfam: Villin headpiece domain (PF02209.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;