Protein coding transcript 176135

• Transcript: Ll_transcript_140681
• CDS coordinates: 152-886 (+)
• Peptide sequence: MASSFTPTNTILGAPSSFITRSLSSPQSIPFQKHNCSLVVRCSATAAPSASSVVKASGEYSVKSVKARQIIDSRGNPTVEVDLVTDQVYRSAVPSGASTGIYEALELRDGDKNVYGGKGVLNAVRNINEFLAPKLVGIDVRNQADVDAIMLEIDGTPNKSKLGANAILGVSLSVCRAGAGAKGVPLYKHIQEISGTKELVMPVPAFNVINGGSHAGNNLAMQEFMILPVGATSFAEALRMGSEG*
• ORF Type: complete

Annotations of Ll_transcript_140681

• Blastp: Enolase 1, chloroplastic from Arabidopsis with 77.73% of identity
• Blastx: Enolase 1, chloroplastic from Arabidopsis with 88.46% of identity
• Eggnog: Catalyzes the reversible conversion of 2- phosphoglycerate into phosphoenolpyruvate. It is essential for the degradation of carbohydrates via glycolysis (By similarity)(COG0148)
• Kegg: Link to kegg annotations (AT1G74030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417521.1)
• Pfam: Enolase, N-terminal domain (PF03952.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;