Protein coding transcript 176194

• Transcript: Ll_transcript_142656
• CDS coordinates: 179-724 (+)
• Peptide sequence: MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA*
• ORF Type: complete

Annotations of Ll_transcript_142656

• Blastp: ADP-ribosylation factor from Vigna with 98.9% of identity
• Blastx: ADP-ribosylation factor from Vigna with 98.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001541)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419536.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;