Protein coding transcript 176301

• Transcript: Ll_transcript_141783
• CDS coordinates: 415-1137 (+)
• Peptide sequence: MMSLTSKSIDFVGKNLIFGGCCSNGSFDSYIVRNYGKVNGGSKMVWCKRRSTQCGVSSVMKIVEPTLNGGTQAIQGLNGLDLKSYSGAPISPAQLFDVVADDLKTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRATAELLGLNELTVKHRRLAEIIEMIHTASLIHDDVLDESDLRRGKETVHQLFGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVSSFIIPL*
• ORF Type: complete

Annotations of Ll_transcript_141783

• Blastp: Solanesyl diphosphate synthase 2, chloroplastic from Arabidopsis with 83.77% of identity
• Blastx: Solanesyl diphosphate synthase 2, chloroplastic from Arabidopsis with 78.02% of identity
• Eggnog: synthase(COG0142)
• Kegg: Link to kegg annotations (AT1G17050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456858.1)
• Pfam: Polyprenyl synthetase (PF00348.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;