Protein coding transcript 176307

• Transcript: Ll_transcript_141774
• CDS coordinates: 3682-4299 (+)
• Peptide sequence: MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVKLDEYLIKSYYKTASLMAASTKGAAIFSGADNSLSEKMYEYGKNLGLSFQVVDDILDFTQSAEQLGKPAASDLSKGNLTAPVIFALEKEPKLRDIIESEFSETGSLDEAIELVKGCGGIERAQELAKEKADLAIQSLQCLPQSVFRLALQDMVAYNLQRIA*
• ORF Type: complete

Annotations of Ll_transcript_141774

• Blastp: Solanesyl diphosphate synthase 1 from Arabidopsis with 80.39% of identity
• Blastx: Solanesyl diphosphate synthase 1 from Arabidopsis with 81.25% of identity
• Eggnog: synthase(COG0142)
• Kegg: Link to kegg annotations (AT1G78510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426033.1)
• Pfam: Polyprenyl synthetase (PF00348.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;