Protein coding transcript 176385

• Transcript: Ll_transcript_141112
• CDS coordinates: 1274-1822 (+)
• Peptide sequence: MQELPIKNPVYLMLGASFGSAAKGTGLKALEFALSMCNSVDMYGFTVDPGYKEWTRYFSESRQGHTPLHGRAYYQMMECLGLIRIHSPMRADPNRVVKWVPSHHLIRAARIASEKLLRRVGAGSGDPLGACSIVKKQVKRNANAISKLRKEALDHMRYVKSTTMYPLEHSPGHGLLCTVPSD*
• ORF Type: complete

Annotations of Ll_transcript_141112

• Blastp: Sialyltransferase-like protein 2 from Arabidopsis with 80.22% of identity
• Blastx: Sialyltransferase-like protein 2 from Arabidopsis with 59.18% of identity
• Eggnog: ST3 beta-galactoside alpha-2,3-sialyltransferase(ENOG410XT8P)
• Kegg: Link to kegg annotations (AT3G48820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006579406.1)
• Pfam: Glycosyltransferase family 29 (sialyltransferase) (PF00777.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;