Protein coding transcript 1764

• Transcript: Ll_transcript_417225
• CDS coordinates: 2-301 (+)
• Peptide sequence: KYQEFKDFQKRILVATNLFARGMDIERVNIVFNYDMPEDSDAYLHRVARAGRFGTKGLAITFASDENDAKVLNSVQDRFDVNITELPDEIDLSSYIDGR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_417225

• Blastp: ATP-dependent RNA helicase WM6 from Sophophora with 88.89% of identity
• Blastx: ATP-dependent RNA helicase WM6 from Sophophora with 88.89% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (Dmel_CG7269)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443385.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;