Protein coding transcript 176502

• Transcript: Ll_transcript_140847
• CDS coordinates: 1589-2080 (+)
• Peptide sequence: MVVFFESLILHNVLFAPEFKFNLISVNRLAKGLNCRMIFDKSQCMIQDMSTLKMIGHAKMQRNLYILTAPSRSLLKANCFVNSIVNVPVFDLWHFRLGHPSFSVLQNMCKDFAYVHFDSHKICDLCHIAKQTKLPFPNKMHRCSEPFDLMHMDIWGPLSISSIH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_140847

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 36% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 25.23% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459936.1)
• Pfam: GAG-pre-integrase domain (PF13976.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;