Protein coding transcript 176557

• Transcript: Ll_transcript_141161
• CDS coordinates: 950-1447 (+)
• Peptide sequence: MGCFILWRHDAEALWFGAGAILNVLLSVWLKRILNQERPTTLKSDPGMPSSHAQSIFFAAFFVILWSVGRIGLNVFTIFVSGLVLASGSFFSYLRVSQKLHTMSQVVVGAAIGSIFSTLWYWLWNAFLLDVFISSIWVRIVVVLGSAGLCLGFFIFTIPHWLQNE*
• ORF Type: complete

Annotations of Ll_transcript_141161

• Blastp: Lipid phosphate phosphatase epsilon 2, chloroplastic from Arabidopsis with 52.73% of identity
• Blastx: Lipid phosphate phosphatase epsilon 2, chloroplastic from Arabidopsis with 50.53% of identity
• Eggnog: PAP2 superfamily(ENOG41128XY)
• Kegg: Link to kegg annotations (AT5G66450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444786.1)
• Pfam: PAP2 superfamily (PF01569.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;