Protein coding transcript 176592

• Transcript: Ll_transcript_140833
• CDS coordinates: 432-1298 (+)
• Peptide sequence: MVRIITLYGKAGMTNHAVKTFHDLHLFRCRRTVKSFNAALNVLSKTRDFDSILLFFSEAQRFDIRVDVYSVNIAVKAFCELGKLQEAYLFMLDSENNAIKPDVITYTTLISAFYKNKRWEIGNGLWNRMVLNGCMPNLATFNVRIQFLVSVRRAWDANSLMGVMRRVGVAPDEVTFNLVIKGFCQAGFIDMAKRVYSALHGKGYKPNLKIYQTMIHYLCKSGDFGFAYTMCKDSMQKNWFPNIDTICLLLEGLKRNGQIQKARMIVTLAEKRIPPFASGHLAAMQSIL*
• ORF Type: complete

Annotations of Ll_transcript_140833

• Blastp: Pentatricopeptide repeat-containing protein At1g80150, mitochondrial from Arabidopsis with 59.52% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g80150, mitochondrial from Arabidopsis with 60.11% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G80150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457215.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;