Transcript | Ll_transcript_140833 |
---|---|
CDS coordinates | 432-1298 (+) |
Peptide sequence | MVRIITLYGKAGMTNHAVKTFHDLHLFRCRRTVKSFNAALNVLSKTRDFDSILLFFSEAQRFDIRVDVYSVNIAVKAFCELGKLQEAYLFMLDSENNAIKPDVITYTTLISAFYKNKRWEIGNGLWNRMVLNGCMPNLATFNVRIQFLVSVRRAWDANSLMGVMRRVGVAPDEVTFNLVIKGFCQAGFIDMAKRVYSALHGKGYKPNLKIYQTMIHYLCKSGDFGFAYTMCKDSMQKNWFPNIDTICLLLEGLKRNGQIQKARMIVTLAEKRIPPFASGHLAAMQSIL* |
ORF Type | complete |
Blastp | Pentatricopeptide repeat-containing protein At1g80150, mitochondrial from Arabidopsis with 59.52% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At1g80150, mitochondrial from Arabidopsis with 60.11% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT1G80150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457215.1) |
Pfam | Pentatricopeptide repeat domain (PF13812.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer