Protein coding transcript 1767

• Transcript: Ll_transcript_417303
• CDS coordinates: 159-575 (+)
• Peptide sequence: MDSEVLEIFNKFDKNGDGKISCAELKDLMVALGSDTTPAEVTRMMAELDQDGDGYVDLKEFGDFHSAGNSDAKELREVFEMYDLDKNGVISARELHAVMRRLGEKCSLGECRRMIGNVDADGDSNVNFQEFKKMMTRS*
• ORF Type: complete

Annotations of Ll_transcript_417303

• Blastp: Probable calcium-binding protein CML27 from Arabidopsis with 53.38% of identity
• Blastx: Probable calcium-binding protein CML27 from Arabidopsis with 51.43% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT1G18210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418699.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;