Protein coding transcript 17675

• Transcript: Ll_transcript_356493
• CDS coordinates: 1890-2753 (+)
• Peptide sequence: MLNNSQGNGEEFINEVSTMGRIHHVNIVRMIGFCADGFRRALIYEFMPNGSLKNFKNSPNNKKSFLGWQKLHEITLGIAKGIEYLHQGCDQRIVHFDIKPQNVLLDNNFTPKICDFGLSKLCSKEQSLVSMTTARGTLGYIAPEVFSRNFGSVSYKSDIYSYGMMMLETIGGRKITEENEENTSHVYYPEWIYNLLEEGEEMRIHIDDEGDAKIARKLAIVGLCCIQWHAAHRPSMQMVIQMLEGTEDRLQVPPNPFASSGPRRKIGSAGMAARQLNQGLEAIQELE*
• ORF Type: complete

Annotations of Ll_transcript_356493

• Blastp: Rust resistance kinase Lr10 from Triticum with 56.65% of identity
• Blastx: Rust resistance kinase Lr10 from Triticum with 50.14% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417901.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;