Transcript | Ll_transcript_44037 |
---|---|
CDS coordinates | 231-704 (+) |
Peptide sequence | MRLRKRKRCFPSCSSLHKVDEDEIYWRRRKEDEELECSHNSTRLISQLAQCFTNAMVGSRSWIGGLFNRANTRRSSSEKFVDYPLSPVEEEKLQRLQEQLQVPYDETCSDHQEALKTLWYCSFPNVSLSGLISDQWKDMGWQGPNPSTDFRYITVTK* |
ORF Type | complete |
Blastp | ELMO domain-containing protein A from Dictyostelium with 34.33% of identity |
---|---|
Blastx | ELMO domain-containing protein A from Dictyostelium with 40.74% of identity |
Eggnog | ELMO CED-12 domain containing(ENOG410XRXC) |
Kegg | Link to kegg annotations (DDB_G0278051) |
CantataDB | Link to cantataDB annotations (CNT0001633) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449003.1) |
Pfam | ELMO/CED-12 family (PF04727.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer