Protein coding transcript 176803

• Transcript: Ll_transcript_44060
• CDS coordinates: 237-545 (+)
• Peptide sequence: MVGSRSWIGGLFNRANTRRSSSEKFVDYPLSPVEEEKLQRLQEQLQVPYDETCSDHQEALKTLWYCSFPNVSLSGLISDQWKDMGWQGPNPSTDFRYITVTK*
• ORF Type: complete

Annotations of Ll_transcript_44060

• Blastp: ELMO domain-containing protein A from Dictyostelium with 34.33% of identity
• Blastx: ELMO domain-containing protein A from Dictyostelium with 40.74% of identity
• Eggnog: ELMO CED-12 domain containing(ENOG410XRXC)
• Kegg: Link to kegg annotations (DDB_G0278051)
• CantataDB: Link to cantataDB annotations (CNT0001633)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449003.1)
• Pfam: ELMO/CED-12 family (PF04727.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;