Protein coding transcript 176919

• Transcript: Ll_transcript_43948
• CDS coordinates: 501-884 (+)
• Peptide sequence: MLAPVDVFVSTVDPMKEPPLVTANTVLSILAMDYPVEKISCYISDDGASMCTFESLSETAEFARKWVPFCKKFSIEPRAPEMYFSEKIDYLKDKVQPTFVKERRAMKREYEEFKVRINALVAKAQKVP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_43948

• Blastp: Cellulose synthase A catalytic subunit 7 [UDP-forming] from Arabidopsis with 91.41% of identity
• Blastx: Cellulose synthase A catalytic subunit 7 [UDP-forming] from Arabidopsis with 89.36% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT5G17420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415363.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;