Protein coding transcript 176921

• Transcript: Ll_transcript_43950
• CDS coordinates: 3-656 (+)
• Peptide sequence: NKLHQFSFLKYNPFSSLNLTKYHTLLCSFLYCIVIFNKLPAMEASAGLVAGSHNRNELVVIHGHEEHKPLKNLDGQVCEICGDGVGLTVDGDLFVACNECGFPVCRPCYEYERREGSQLCPQCKTRYKRLKGSPRVQGDEEEEGVDDIEHEFKIDDQMNKHGYVAEAMLHGKMSYGRGPEDDEHSQFPPVISGGRSRPVRFKTFSFHFNVLIAVVVAI
• ORF Type: internal

Annotations of Ll_transcript_43950

• Blastp: Cellulose synthase A catalytic subunit 7 [UDP-forming] from Arabidopsis with 80.65% of identity
• Blastx: Cellulose synthase A catalytic subunit 7 [UDP-forming] from Arabidopsis with 80.65% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT5G17420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417209.1)
• Pfam: Zinc-binding RING-finger (PF14569.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;