Protein coding transcript 176928

• Transcript: Ll_transcript_43738
• CDS coordinates: 3-338 (+)
• Peptide sequence: GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGARAMLNFPLRVNSGEPDPVRVTSKRVSPEPSSSSENLSVAKKKKKTVVPTAQVVTSQVAQYTRGGQLLVS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_43738

• Blastp: Ethylene-responsive transcription factor 2 from Nicotiana with 58.73% of identity
• Blastx: Ethylene-responsive transcription factor 2 from Arabidopsis with 90.91% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107769743)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445039.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;