Transcript | Ll_transcript_44649 |
---|---|
CDS coordinates | 209-1261 (+) |
Peptide sequence | MHKSPSGLSLGSDGLDLTQVFFKPITNAAPPSPTNRQTKISVIGAGNVGMAIAQTILTQDLTDELVLVDAKPEKLRGEMLDLQHAAAFLPRTKISASVDYAVTAGSDLCIVTAGARQISGESRLNLLQRNVSMFKNIIPHLVRYSPHSTLLIVSNPVDILTYVAWKLSGFPSNRVIGSGTNLDSSRFRFLIADHLDVNAQDVQAYIVGEHGDSSVALWSSISIGGVPVLSFLESQQIAYEKETLENIHIAVIDSAYEVISLKGYTSWAIGYSVASLARSILRDQRKIHPVSVLAKGFYGIEDGEVFLSLPAQLGRGGVLGITNVHLNDEESQRLRDSAKTILEVQTQLGI* |
ORF Type | complete |
Blastp | L-lactate dehydrogenase A from Hordeum with 66.86% of identity |
---|---|
Blastx | L-lactate dehydrogenase A from Hordeum with 66.86% of identity |
Eggnog | Catalyzes the reversible oxidation of malate to oxaloacetate (By similarity)(COG0039) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446710.1) |
Pfam | lactate/malate dehydrogenase, NAD binding domain (PF00056.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer