Protein coding transcript 17704

• Transcript: Ll_transcript_355842
• CDS coordinates: 39-398 (+)
• Peptide sequence: MCNIRLLIIKCDLHLQIGIKCLSSSLKVVIWERYPLKALPLDVQLDELVYLKMRYSEIEKLWNGTHFFRKLKLIDLSYSEGLIETPDISGAPNLKELYLRGCVKLVKVHYSVGLHKKLEG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_355842

• Blastp: Disease resistance protein TAO1 from Arabidopsis with 41.32% of identity
• Blastx: Disease resistance protein TAO1 from Arabidopsis with 41.6% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G44510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441909.1)
• Pfam: Leucine Rich Repeat (PF07725.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;