Protein coding transcript 177041

• Transcript: Ll_transcript_44899
• CDS coordinates: 393-803 (+)
• Peptide sequence: MWFFNCGFLIRVVVLPSMTVQEHAGNEKSCVWHARDFADGELKDELFCIRFQSIENAKKFIESFQEVAESQNPAEESKDASAAAGLLENLSVEGNNDADKKDEEKSDNKTAEEESSSGKESKADTEKKSEEPASSA*
• ORF Type: complete

Annotations of Ll_transcript_44899

• Blastp: Ran-binding protein 1 homolog b from Arabidopsis with 58.06% of identity
• Blastx: Ran-binding protein 1 homolog b from Arabidopsis with 64.52% of identity
• Eggnog: ran binding protein(COG5171)
• Kegg: Link to kegg annotations (AT2G30060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413072.1)
• Pfam: RanBP1 domain (PF00638.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;