Transcript | Ll_transcript_44899 |
---|---|
CDS coordinates | 393-803 (+) |
Peptide sequence | MWFFNCGFLIRVVVLPSMTVQEHAGNEKSCVWHARDFADGELKDELFCIRFQSIENAKKFIESFQEVAESQNPAEESKDASAAAGLLENLSVEGNNDADKKDEEKSDNKTAEEESSSGKESKADTEKKSEEPASSA* |
ORF Type | complete |
Blastp | Ran-binding protein 1 homolog b from Arabidopsis with 58.06% of identity |
---|---|
Blastx | Ran-binding protein 1 homolog b from Arabidopsis with 64.52% of identity |
Eggnog | ran binding protein(COG5171) |
Kegg | Link to kegg annotations (AT2G30060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413072.1) |
Pfam | RanBP1 domain (PF00638.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer