Transcript | Ll_transcript_355845 |
---|---|
CDS coordinates | 36-368 (+) |
Peptide sequence | MCDLHLQIGIKCLSSSLKVVIWEKYPLKALPLDVQLDELVYLEMFYSKIEKLWNGIHFFRKLKRINLSYSEDLIETPDISGAPNLKELYLRGCVKLVKVHYSVGLHKKLEG |
ORF Type | 3prime_partial |
Blastp | Disease resistance protein TAO1 from Arabidopsis with 38.52% of identity |
---|---|
Blastx | Disease resistance protein TAO1 from Arabidopsis with 38.52% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT5G44510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452279.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer