Protein coding transcript 177083

• Transcript: Ll_transcript_42859
• CDS coordinates: 235-639 (+)
• Peptide sequence: MTTTGTQAYGEAWYWDNRYSNEPGSFDWYQKYPTLAPIINLYVHHSQPIPVIGAGNSVFSEGMVDDGYMDVVNIDISSVVIEAMQNKYRDRPHFKYIKMDVRDMSPFESGSFGAIIDKGELTFLFIIDFFWCHY*
• ORF Type: complete

Annotations of Ll_transcript_42859

• Blastp: Methyltransferase-like protein 13 from Mus with 37.29% of identity
• Blastx: Methyltransferase-like protein 13 from Mus with 37.29% of identity
• Eggnog: methyltransferase like 13(ENOG410XNZZ)
• Kegg: Link to kegg annotations (71449)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424768.1)
• Pfam: Methyltransferase domain (PF08241.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;