Protein coding transcript 1771

• Transcript: Ll_transcript_417319
• CDS coordinates: 3-320 (+)
• Peptide sequence: PLFPCLERHTYISIISQVSFLCLTLNSIFFLAFFLKKYCLEMKVVRFFTLPILILQLMAITTHFGEAHDLANSPTPPPTSDGTALDQGVAYLLMLVALAITYTFH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_417319

• Blastp: Arabinogalactan peptide 22 from Arabidopsis with 61.54% of identity
• Blastx: Arabinogalactan peptide 22 from Arabidopsis with 61.54% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G53250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457517.1)
• Pfam: Arabinogalactan peptide (PF06376.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;