Protein coding transcript 177105

• Transcript: Ll_transcript_42980
• CDS coordinates: 113-589 (-)
• Peptide sequence: EPRVLTVETDKDMQKHLDEKLIHDFRTSNANDDSVSYIEKVVNNGEDTVAAIRTIDGIHDLFIVGRGQGMISPLTAGITDWSECPEIGAIGDLLASSDFAATASVLVVQQYVGVGSNGEGMDTPESKVQTNEEFISELSQHSAPPPRGGHNVFNTERL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_42980

• Blastp: Cation/H(+) antiporter 15 from Arabidopsis with 64.8% of identity
• Blastx: Cation/H(+) antiporter 15 from Arabidopsis with 64.8% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT2G13620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416225.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;