Transcript | Ll_transcript_43651 |
---|---|
CDS coordinates | 332-1096 (+) |
Peptide sequence | MDFIHTPEYHVIVGVAVAVVAVGVGAFYLYSSKKPKGCLDPENFKEFKLVKRDQLSHNVAKFRFELPTSTSVLGLPIGQHISCRGKDGQGEDVIKPYTPTTLDSDVGYFELVIKMYPQGRMSHHFREMRVGDYLAVRGPKGRFKYQPGEVRAFGMLAGGSGITPMFQVARAVLENPKDRTKVHLIYANVTYEDILLKEELDGLASNYPGQFKIYYVLNQVGFYFMQIYNFHLIYYVCFFCFIKVELSCKIFVSR* |
ORF Type | complete |
Blastp | NADH--cytochrome b5 reductase 1 from Arabidopsis with 88.6% of identity |
---|---|
Blastx | NADH--cytochrome b5 reductase 1 from Arabidopsis with 88.6% of identity |
Eggnog | cytochrome-b5 reductase activity, acting on NAD(P)H(COG0543) |
Kegg | Link to kegg annotations (AT5G17770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434873.1) |
Pfam | Oxidoreductase FAD-binding domain (PF00970.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer