Protein coding transcript 177136

• Transcript: Ll_transcript_43645
• CDS coordinates: 182-808 (+)
• Peptide sequence: MYCAHIVTSYSLNRGKDGQGEDVIKPYTPTTLDSDVGYFELVIKMYPQGRMSHHFREMRVGDYLAVRGPKGRFKYQPGEVRAFGMLAGGSGITPMFQVARAVLENPKDRTKVHLIYANVTYEDILLKEELDGLASNYPGQFKIYYVLNQPPEVWDGGVGFVSKEMIETHFPAPAHDVKTLRCGPPPMNKAMAAHLDAIGYAPEMQFQF*
• ORF Type: complete

Annotations of Ll_transcript_43645

• Blastp: NADH--cytochrome b5 reductase 1 from Arabidopsis with 87.69% of identity
• Blastx: NADH--cytochrome b5 reductase 1 from Arabidopsis with 87.69% of identity
• Eggnog: cytochrome-b5 reductase activity, acting on NAD(P)H(COG0543)
• Kegg: Link to kegg annotations (AT5G17770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434873.1)
• Pfam: Oxidoreductase FAD-binding domain (PF00970.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;