Protein coding transcript 177143

• Transcript: Ll_transcript_44709
• CDS coordinates: 108-548 (+)
• Peptide sequence: MRPNCCHNSLAFVLKFLNFLQAFIGVSIILYSTWMFNQWNHHIPKPPLPNPVTFPFHSHPSLRDSFGFDVDSINLPAPWFIHAFMGVGIVVCCVTFFGCIAAEMINGCCLCFVSYLEWRYISFHVLVSLDENLFIFCSELLIENLC*
• ORF Type: complete

Annotations of Ll_transcript_44709

• Blastp: Tetraspanin-18 from Arabidopsis with 50.36% of identity
• Blastx: Tetraspanin-20 from Arabidopsis with 56.25% of identity
• Eggnog: NA(ENOG410YNZE)
• Kegg: Link to kegg annotations (AT2G20230)
• CantataDB: Link to cantataDB annotations (CNT0002520)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459323.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;