Protein coding transcript 177194

• Transcript: Ll_transcript_43122
• CDS coordinates: 1177-2112 (+)
• Peptide sequence: METPATKFTPNVRSASYAEIGPRVSMEDEHIRIDDLAAHLGFVFQCPIPSAFYAVFDGHGGPDAANFVKRNAMTLFFEDANMLRSYDTDAFFMKKLEESHRRAFLRADLALADGQTVNSSSGTTALTALVLGRHLLVANAGDCRAVLCRRGKAVEMSQDHRPSYLPERRRVEELGGFIDDGYLNGYLSVTRALGDWDLKFPLGAASPLIADPDVQLVTLTEEDEFLIIGCDGIWDVMSSQYAVSLARRRLRRHDDPQQCARELVKEALRLNTSDNLTVIVICLSSVESIAESCPPRRRRFKACSLSEEACN*
• ORF Type: complete

Annotations of Ll_transcript_43122

• Blastp: Probable protein phosphatase 2C 2 from Oryza sativa with 63.11% of identity
• Blastx: Probable protein phosphatase 2C 2 from Oryza sativa with 59.82% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (4326717)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419147.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;