Transcript | Ll_transcript_417267 |
---|---|
CDS coordinates | 61-438 (+) |
Peptide sequence | MVRTNVLADALKSINNAEKRGKRQVLIRPNSKVIVKFLSVMMKKGYIGEFEVVDDHRAGKIVVNLTGRLNKCGVISPRFDVPIPEIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKIL |
ORF Type | 3prime_partial |
Blastp | 40S ribosomal protein S15a from Sophophora with 91.27% of identity |
---|---|
Blastx | 40S ribosomal protein S15a from Sophophora with 91.27% of identity |
Eggnog | One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit (By similarity)(COG0096) |
Kegg | Link to kegg annotations (Dyak_GE16163) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004513036.1) |
Pfam | Ribosomal protein S8 (PF00410.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer