Protein coding transcript 17721

• Transcript: Ll_transcript_355704
• CDS coordinates: 277-645 (+)
• Peptide sequence: MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRVVEARDELHRMLNEDELRDAVLLV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_355704

• Blastp: ADP-ribosylation factor from Vigna with 99.19% of identity
• Blastx: ADP-ribosylation factor from Vigna with 99.19% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001084)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419536.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;