Protein coding transcript 17727

• Transcript: Ll_transcript_355723
• CDS coordinates: 2-391 (+)
• Peptide sequence: EYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKVPSYI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_355723

• Blastp: ADP-ribosylation factor 2 from Oryza sativa with 99.19% of identity
• Blastx: ADP-ribosylation factor 2 from Oryza sativa with 99.19% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (4339157)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016205724.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;