Protein coding transcript 177296

• Transcript: Ll_transcript_42775
• CDS coordinates: 165-656 (+)
• Peptide sequence: MEEYNSSGTKKARLHSVLTTLLDDPVLADVPKNPTLADVDTLISLELGSAMRISIFKLDGTSFDVTMMNSATVKDLKLAIKKKVNDMEQSSMGHRHISWRHVWANYCLSHHNSKLLDDDDKLQNFGIRNSSQVQFIPYVMTKESRRHSKRRKHRFFHGLNKLS*
• ORF Type: complete

Annotations of Ll_transcript_42775

• Blastp: U11/U12 small nuclear ribonucleoprotein 25 kDa protein from Arabidopsis with 68.39% of identity
• Blastx: U11/U12 small nuclear ribonucleoprotein 25 kDa protein from Arabidopsis with 70.15% of identity
• Eggnog: u11 U12 small nuclear ribonucleoprotein 25 kDa(ENOG4111HGM)
• Kegg: Link to kegg annotations (AT3G07860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454264.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;