Transcript | Ll_transcript_44813 |
---|---|
CDS coordinates | 151-1017 (+) |
Peptide sequence | MSASTASLAKDEKVQGEGIGSLNSVEDQHGGVIVNMEEPMDSLDFASLLEASLSQWKEQGKKGVWIKLPIEHSNLVASAVKVGFRYHHAEPDYLMLVYWIPDTPDTLPANASHRVGIGAFVMNTNREVLVVQESNGRFSGTGIWKLPTGAVNEGEDICTAAIREVKEETGIDTEFVEVLAFRQSHKAFFQKSDLLFVCMLQPHSLNIQRQASEIDAAQWMPIQDYVAQPFVQENELFDFLTKIWLSKLDGKYTGFSSLLTSTSSLKKSYLYFNNNDPNLFLSSKHVQP* |
ORF Type | complete |
Blastp | Nudix hydrolase 2 from Arabidopsis with 59.42% of identity |
---|---|
Blastx | Nudix hydrolase 2 from Arabidopsis with 61.96% of identity |
Eggnog | NUDiX hydrolase(ENOG4111WDN) |
Kegg | Link to kegg annotations (AT5G47650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459774.1) |
Pfam | NUDIX domain (PF00293.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer